TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F2NJV5|F2NJV5_DESAR Uncharacterized protein OS=Desulfobacca acetoxidans (strain ATCC 700848 / DSM 11109 / ASRB2) GN=Desac_2070 PE=4 SV=1
MLSHWWVLYGLGAALGLASSDALMKRWFSDLSPYGMTLLRLLYTVAILSVGWWWTPVPDLSWQFFLAVAAALPLEAGANL
LYMRALRSTPLSVCAPMMAFTPLFLIGAGWLLLGEKLNFWGILGIVGIVWGSYLINIQEQRRGWLAPWSALWRLPGPRWM
LMAAVLYSITSALGKIAVLYSSPTFFGLFYPTVFGGAMLAGYPWSSSKPGRMLLKRPIWGLLVGFCLAVSILCHFHGIKL
APVAYLIAVKRLSLLFSVLYGGFFFREEHFGARFAGASCMTAGVVLITGWGS