TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F3LB58|F3LB58_STRPO Putative membrane protein OS=Streptococcus porcinus str. Jelinkova 176 GN=STRPO_0189 PE=3 SV=1
MLSIQKKVPGILICLMIAVPAWILGQVLPIIGGPVFGILLGMLVAFFYHSREKGQAGIGFTSKYILQIAVVLLGFGLNLT
QVVKVGLSSLPIIISTIVTALLVAFFLQKALRIDVHTATLVGVGSSICGGSAIAATAPVIGAKDDEIAKAISVIFLFNII
AAMLFPSLGQLLGLSNHGFALFAGTAVNDTSSVTATAASWDALHQANTLDEATIVKLTRTLAIIPITLGLASHNVRKEKH
SPAQNNFSWKKAFPTFVLFFLMASLVTTLVSALGIHLALFEGLKTLSKFFIVMAMAAIGLNTNLVKLVKSGGKAIILGAA
CWCAITCVSLLMQILLGVW