TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F4BT81|F4BT81_METSG Cytochrome c biogenesis protein, transmembrane region OS=Methanothrix soehngenii (strain ATCC 5969 / DSM 3671 / JCM 10134 / NBRC 103675 / OCM 69 / GP-6) OX=990316 GN=MCON_3047 PE=4 SV=1
MAVKDGVGGLSKPGSNPPHALILPVSIISLFALLFISLSISPALADEAQAPDFFATSWDQRSFNLSDFMGSPVVLHITNI
ENPLCIECEKSLSGQVEELAALKALDTNVQIVTLNLRKNPYSIDGRELAQTWWEVNITWPWIEDLDPYPIGSKYLDYWTV
RGGSSNPTIVLIDREGRIGPVYHVYRVGEGIEDGVQKAQSLLDDIQELNGTALMVEGEASPPAEVEARPEGAAGIFSALW
TRMENEVSRKDVTAFGMFLLGIFTSLAPCSIALMIAVFSYVMTVRRKDEYLRASASTSREGFMIGVAFTLGMAVVFFVLG
LFISQIGVFFRDSKIFDLLAGSIMVMLGIGSFKPLGEIIEPVTSRMRFHQAGVDGTDEPSDGPGSASLAEPMEEEKSLLQ
KAVEFSLNLFRYSAFIGAFTLGIFFALGWAPCALSMVMPVLIWLASQDVAPLVGGTMLFFFGIGHGVPIIPITTFSRMVG
GRIGEKYISVGEWTSKIFGLLVILVGLVYAARYFGYLLW