TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F4JTB2|F4JTB2_ARATH Protein DETOXIFICATION OS=Arabidopsis thaliana GN=DTX35 PE=3 SV=1
MDPTAPLLTHGGEVEEDYAPARSWTDVKRVLSTESAKLWMIAAPVGFNIICQYGVSSVTNIFVGHIGEVELSAVSISLSV
IGTFSFGFLLGMGSALETLCGQAYGAGQVNMLGVYMQRSWIILFVSCFFLLPIYIFATPVLRLLGQAEEIAVPAGQFTLL
TIPQLFSLAFNFPTSKFLQAQSKVVAIAWIGFVALSLHVIMLWLFIIEFGWGTNGAALAFNITNWGTAIAQIVYVIGWCN
EGWTGLSWLAFKEIWAFVRLSIASAVMLCLEIWYMMSIIVLTGRLDNAVIAVDSLSICMNINGLEAMLFIGINAAISVRV
SNELGLGRPRAAKYSVYVTVFQSLLIGLVFMVAIIIARDHFAIIFTSSKVLQRAVSKLAYLLGITMVLNSVQPVVSGVAV
GGGWQGLVAYINLGCYYIFGLPFGYLLGYIANFGVMGLWSGMIAGTALQTLLLLIVLYKTNWNKEVEETMERMKKWGGSE
TTSKDILASGWPSGLRRQTQVLVFVRGRGFKPHF