TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F4LLK3|F4LLK3_TREBD Exporter of the RND superfamily protein-like protein OS=Treponema brennaborense (strain DSM 12168 / CIP 105900 / DD5/3) GN=Trebr_1239 PE=4 SV=1
MSLSKINAWFQKAGAFQIRHRKLFLACILIVSIAGLTGLSRLRIEDNQDGWFDDTEQIQIDQDTFKAVFGNEDAVMVLVQ
APDVFDPLVLDAIDRLGKRLEAEVPFADRVTSLTELSVSRGTDDGFEIVNPFEDGIPGGGRPLAELTEAERAELAEKKAF
ILSRSALVNNLVSDDAAETWVILSLLPFEDDFADQYEVGDAAIAVLESAEFAGGAYTMKASGMSYTETEERAVILKEAAL
RVSSGFIVMLLCLVFFVKSLRGVLVPIAATALGIGSVLGFCGWFGIAADSTLITLPILLGMALSVGYSIHYINAFRLQFR
NSGKRAESAVAAVKETGWPILFTVVTTVGSMISFMTVGIGPLKWLGATCAAIVFAVYVYVIVLIPVLLSYGKDSSMASVP
TPKDVQLKEKAEQTDRRFERFGAFVLKHKTAVLLFGTLVTAASVAGIFRMTVNMDYIEMMGKRIPYVARLQSILEAKLGS
QYSYNVMIEFPEADAFKNPLTVQALERETAELGTLRLTRVSGGKPRVTSVVDIVKEMHQTLNGDDPAFYTVPDDPDLLTQ
LLFLYEISGGENLSNWLDDDYRTTFIHVELSGYDANDIVQDIADARRSAESLFPQANVSVVGTVVNFAEMNHKLVVGELK
SFMGSFLIIALLLTLAFGSVRMGLIGMIPNLAPVALIGGIMGYCGFSLDMLTMTIMPMILGIAVDDTIHFTNHVKYQFES
TGNYRLSILATYREIGKTLVMTTVILCAMFLMYTFSPMATLFRVGLLAIIGLGSALIADYTLTPVLIYLTKPFGKER