TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F4TJX1|F4TJX1_ECOLX Inner membrane protein YqcE OS=Escherichia coli M718 GN=ECJG_01089 PE=4 SV=1
MQHNSYRRWITLAIISFSGGVSFDLAYLRYIYQIPMAKFMGFSNTEIGLIMSTFGIAAIILYAPSGVIADKFSHRKMITS
AMIITGLLGLLMATYPPLWVMLCIQVAFAITTILMLWSVSIKAASLLGDHSEQGKIMGWMEGLRGVGVMSLAVFTMWVFS
RFAPDDSASLKTVIIIYSVVYILLGILCWFFVSDNNNLRSANNEEKQSFQLSDILAVLRISTTWYCSMVIFGVFTIYAIL
SYSTNYLTEMYGMSLVAASYMGIVINKIFRALCGPLGGIITTYSKVKSPTRVIQILSIIGLLALTALLVTNSNPQSVAMG
IGLILLLGFTCYASRGLYWACPGEARTPSYIMGTTVGICSVIGFLPDVFVYPIIGHWQDTLPAAEAYRNMWLMGMAALAM
VIVFTFLLFQKIRTADSAPAIASSK