TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F6EHL8|F6EHL8_AMYSD Putative exporter of polyketide antibiotics-like protein OS=Amycolicicoccus subflavus (strain DSM 45089 / DQS3-9A1) GN=AS9A_3946 PE=4 SV=1
MRESCTGTGELVRLMMRRDRLVLPWWVLALTMLPVLQAYGTPNLFPTDAQLRSYAATLQTPAFVALYGPVFEANPGSLAL
TRSGIAPVIVALIAALIVIRHTRTEEESGRTELLATTVVGRYAGLAAALITVSIGLALLGTLLAVGMLAVGLPLAGSIAV
GASYAGAGLMFAAIGAVAAQLTVSAGGARAIASAAIGFAFAVRLSGDVSDATGGSLGWLSFLSPIGWVHQARPFAGEQWW
VFVPITAFTVALTAVAVVIAGRRDSGAGVLPSPLGPPTAGRALSWPEGVAWRLHRVALFGWAAGFVLLGFVLGSAGRGIE
SLFADNPALHQALERLGGTQTVVDAYFAGIMGFLGLLASGYAIAGVLKLRGEETSLRAELLLNAPVSRIRWALGHIGISL
VGAVVLLILGGSAMGVAHGISVGDLSGQVPRLAGAALVQLAAVIVLAAIAVAAFGLLPRFAYSVSWTALAAVFLIGQVGA
VLELGQWALNVSPFTHLPRLPGGAFEGLPLLVMALLAFSVTTAGLAAWRRRDMTGAG