TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F6EHL9|F6EHL9_HOYSD Putative ABC transporter ATP-binding subunit OS=Hoyosella subflava (strain DSM 45089 / JCM 17490 / NBRC 109087 / DQS3-9A1) OX=443218 GN=AS9A_3947 PE=4 SV=1
MANAVEIAGLGKSFGRTRALDGLTMTVVEGEVHGFLGPNGAGKTTALRILMGLLRADRGSVRVLGSDPWADAVALHRRIA
AVPGDVALWPSLSGGETIDMLGRLRGGLHPGRRAELVERFALDTTKKARSYSKGNRQKVALIAALASDAELLLLDEPTAG
LDPLMEAVFQECMREARSEGRTVLLSSHILAQVEALADRVSIIRKGIIVESGSLADLRHLTRTTIVARTRKSPEELANAQ
GVREFDAREGEVRFEVDSEHVEAVVNRLAALGVRSLVAHPPTLEQILLRHYDDVLHATETPDA