TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F6ES94|F6ES94_HOYSD Uncharacterized protein OS=Hoyosella subflava (strain DSM 45089 / JCM 17490 / NBRC 109087 / DQS3-9A1) GN=AS9A_3660 PE=4 SV=1
MDATSTASPWPKAIGIACALSLVVGLLLAAFAWPAARSAPADLPIAVAGPPAAVAEFSAQLNDRAPGVFAITEANDASVA
EALVTDREVYGAFVLSPGSPPALLTASAASPVVAHLLTGVASGPAMSDVNDLVPFTADDPRGAGFAAAALPMVMGGLLIG
VASSLALAGAARRMVAVLLGAALSGLVAGFVAQGWLGVLAGSYWINSAAIALTIGAIGITLVGLHSVLGHAGIALGAVTV
FLIGNPLSGVAVAPEMLPGSWGTVGQFLPPGAGADLLRSVSFFDGMGSAQPTLVLAFWGLAGLLLILAGVLRGRRD