TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F6X3Y1|F6X3Y1_CIOIN Uncharacterized protein OS=Ciona intestinalis GN=LOC100185148 PE=4 SV=2
MASSWAFKTTASLIKPTREALLDYCAYILLVIAIIGTTRIIIGRSELQQLCPRKTFIQSNTSQPLTHEFNKTGDIVLTKP
NLDKETRQFVLQSNLKVHLVKDLKVAEGEDDISVHKQKQDFNSSVLYFCLKHYQAYLPYFLLAESAVLLLIGILWVKMPS
VQLLIKEFASILHECRQSTWYVSVADVLQSESTIPVTQSLFTLMKSDAVNMEMILLLETLFRPNSAYLNKSQARRLYERV
QKFCIENENSVVLLDSYISKSIVQLIAWMLFFFINMVLFVKFEFYSTCGWSEVCEHDTFLRIIWYMAQLLVLVYGIFNCS
ALKWINDKAVYINRPRRNFLCCEDDNDDSSSKKRKFVKCRPFKVGQDQTVVHNDLALLLHLASSSNHKTITYFTIFLFDQ
WKEKFSQPVEDVHIESPVKQKLVKQFPARKSNSSSHPLLTKSSSYGKVSFFIESPQDEATDSPSSSSKTSGDVSDRISST