TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F6ZCH7|F6ZCH7_ORNAN Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
THAAFLGFVDFHQELECPLEVRHRCGSLCDQRRAIDNTQARFVHSSEHQHGILTPRILPGESVLASPVCCHHQSDENLES
SSYRLKTTILAENEVEANKLSNNYKFGFKKWKSHVTARPWEDRSEITKELYSDLCVVRSPAGSTVTCGNVFYLLLFGWWV
SSVYLLVSVLMFLSVLGAPYGKLCWSLAGYFLWPFGKVIQKVGEATEYKVCLQQANQDPLPDGKRCWRGPELQTKPGVSS
PRQHRVSTYIWLLLGFPILVVTHVLVCCCSWLLVVIIPIAKMSVRTVTRVLLEAPEQVHVQSAKETEISPEGDVLLCCYR
ATNAYYYKYSVDGINVFAVNLLPLVIVTLVLGYMDSQNQYTSSLVKFTLSLLSIMPLSYYIGMAIASISAQSTFAVGAVV
NATFGSVIELTFYITALIKGAHEGSRCYEEVVKAALTGTVLGCTLLVPPGLPFIPPGLRRERREFPDDSQGASRLALWEK
CGGILWDLCQSLALGLPLLEKASSNDPSLGKYTCILRGVGKVENNGTLYYSHVQPLVYTVSLLLPFAYLIGLFFTLKTHS
HIYDIHVSDLLVPGHHHRAVVHWPRWRALLLLLLSTLCMSACADLATKHISPILESSTVSQYFIGVTVLAMVPELPEIIN
GIQFALQNNLSLSIEIGNCIAVQVCMLQIPILVLFSIFYPTGFKLLFSDLHVYASMFSVILMNYIFMDGKCDYFQGTVLV
MVYLILLAVYFFAPSPAGC