TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F7K9Z4|F7K9Z4_9FIRM Uncharacterized protein OS=Lachnospiraceae bacterium 3_1_57FAA_CT1 OX=658086 GN=HMPREF0994_02677 PE=4 SV=1
MEEKDKEYSILQNFVYCIKATIQNYPKLLVLCVSLIVINAAIPVITTFLPKVVIDEIVNQKPLEHLMFATGLFLGTIIIM
TSLQKYIDRLIYWHKYKMNTYFLKMVTNKSLRTDYCNQEDEHFRNLQSESFASCNGNFSYYAQIYDTSVGFMANLLGFVT
FFYVLIRLNIIIVFFLVISTLASYFMNKRIIKWEKVNNEEKISYTQKLQYITKVSGEIKAAKDIRLYNMIAWLNSVYRVN
MEGVNSWYKKYASKIFKVSICDCSFSLVREGVTYFYLLYLVLQGTLTVADFVLYFNVIVGFSAWLNSLLGQVNTINRLNV
SINRFRTFVEYPEKYCRNSGEKIHDFLKPRTIELKNVSYQYSGEDSKVIDDLSLTINPGQHLAVVGLNGAGKTTLVKLIC
GLIDPTEGQVLYDGKDLKELDRDDVYKAFGVVFQQYSILPVTIAEIVAENIRENVNVDRVKKCLEQAGLIEKINSLKYGL
DTKYDKTMWEDGIDLSGGEKQKLLLARALYKNSPIVILDEPTAALDPISEQNMYELYNGVMDSKSSIFISHRLASTRFCS
HIILLENGKIIECGTHDELLSLHGKYYELFETQAKHYREEKVDEYEHS