TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F8FLY4|F8FLY4_PAEMK Spore germination protein OS=Paenibacillus mucilaginosus (strain KNP414) GN=KNP414_06379 PE=4 SV=1
MAKLSSYETFSLMFGLLLGTSVIFGTPKLVHDLWLVDIMALIPGLLMAWIYYTALGALGQRKGLYNLLVEAWGKYCGKLL
ILSYTVYFLYIAARNVRDMVELVKITLLRDTPEWIITIMFVLVAAYAVGGGIKVIGRFAEITTALVIIFFLGILLLLLMS
GYIQLEKMLPFLPNGLLPILKESLAINLWFPYGEMVVFLVLYNNLCAPDQIRKVGLAAVLSAGLLLTMSDLLQTWVLGVE
QQQISAFPLLDSARLINVGNFITRMDALVAFIIMFGVMVKSAIFLYAGTKGLSLVFQTSSRNYVYPLSLVIGAVSLMVSE
NFAEHGTEGLQTVIKILHIPHQLILPLITGLMVWIRMKRRERADEALG