TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F8KX85|F8KX85_PARAV Putative uncharacterized protein OS=Parachlamydia acanthamoebae (strain UV7) GN=PUV_06020 PE=4 SV=1
MPDNKSPSHFKGKDAIDHVVEAQAEGLMASAEIHGVEMPGHLSAGTDAAREMALGLLLLGIVLFKSGLYLGTTWKLLLIF
ALSWAIWKAGRSAWLGWSRLERLHRVLKQEKWEIEHNRAQEKEELKDLYAAKGFDGQLLEDAVDVLMADGDRLLRVMVEE
ELGLSLEKTEHPLMQGVGALVGALLGATICLLTEWLVPYYGLIVGSFVVGGVASAYAAYQIGNRYIPAIVWNLGLFCLSA
GFLYFLIPYVLG