TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F8KY45|F8KY45_PARAV Putative uncharacterized protein OS=Parachlamydia acanthamoebae (strain UV7) GN=PUV_27380 PE=4 SV=1
MIPGFSLYSDAVPESSPVKIELIYDQSSLQADVPFWVGIRLQHQEGCHSYWKNPGDAGFATHIDWNLPQNIQAGEIEWPI
PQKFSSNSTVGMGYEGDILLLTKMTPTKEFAGGNVEVKAVIHWLVCSDANCMPGETEVTLTLPVHPNSQSNMWKEMVSSA
VEKLPTNHEKIRAVRKDGLIVIHLSGVDQIASPTSAFFPETAELVDLKKEPIATSTSNSAGEYLITMAEGSSASDRLKGV
LLLHNVSESEPIALNIDLPIHGDEKALIGFVDPQDLKKAVVLGNQSNDEIASTGSEFEGGLGLALLFAFVGGMILNLMPC
VLPVISFKVLSFVKMSGQNRLLVLKHGMMFTLGVLVSFWALAIAMLVLQVYGKSVGWGFQLQEPIFVVILATGLMIFALS
LFGIFEFGTFFASLAGQAQANPGTKKEGLSGSFFSGVLATAVATPCTGPFLGSAIGFAVTLPPVYALLVFTCLGLGMAFP
YLLLSFFPSLLAFLPKPGNWMVTFKELMGFMMMATVLWLLWVYSAQTSSMALLMVLFAFLLITLGFWAYGRWGTLINSKR
TRFLSGAFALTCLMVGCYTVYLSASLPPETSIASYEXGEWEPFSAERVAELQKQGVPVFIDFTAKWCLICQTNHLVLSME
KVENKFQELGVVKMKADWTSNDEEITKVLRQFGRNGVPLYLLYGASEGSPTILPQVLTPDVVIEHLSAVEGDLKKIASSE
GDSLESNH