TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F9UFQ4|F9UFQ4_9GAMM Putative uncharacterized protein OS=Thiocapsa marina 5811 GN=ThimaDRAFT_3757 PE=4 SV=1
MSDRLRITWYGVTIFLSSAFLLVLEILAGRLIAPYVGVSLYTWTAIIGVILAGLSLGNWLGGIWADRGGNELAAGITLAL
AGLFSLGILFLLTLVAPLIEAREMTLLGASFFYVLALFFMPAVLLGVVTPLLTTLALGMDRRTGHIVGRMHALAALGSIL
GTFITGYVLIQYLGTRGIVIGTALGLFLLALPFFKGRSRVAPVAALVAAVGLILVTDARNGFSNPCDRESNYFCIRVIDD
SERAPLGVARSLVLDHLIHGTNHDSEPGMLISPYVQLMDELALEHFGEDKAETLRWFFAGGGAYTLPRSVRSRTPNATVA
VAELDPLVTRTAEDGLFLDTEGMRVVHADARIVLTREPSECYDVIVSDAFHDISIPYHLVTHEYAELVKSRLAPDGIYLL
NVLDAFPDPRLVKSMMKTLSESFEHVHVWMDMVPPEAERMTFVISASDAREPPETLVARRGFDHRWLRVTEPMMRTGTAF
DALPLLTDNYVPVERLVSEFYFEDLGR