TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G0LRW8|G0LRW8_STAAU ABC transporter permease protein OS=Staphylococcus aureus subsp. aureus LGA251 GN=mntB PE=3 SV=1
MLEFVEHLFTYQFLNRALITSIIVGIVCGTVGSLIVLRGLSLMGDAMSHAVLPGVALSFLFGIPMFIGALITGMIASIFI
GYITSSSKTKPDAAIGISFTAFLASGIIIISLINTTTDLYHILFGNLLAITNSAFLTTIVIGSIVLILIIIFYRPLMIST
FDPTFSRMSGLNTTLLHYFVMLLLSLVTVASIQTVGIILVVALLITPASTAFLISKKLYSMMIIASLISVISSIVGLYYS
YIYNIPSGATIVLCTFVIYIITLFFTKFTNRKKRGSLT