TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G0LRW9|G0LRW9_STAAU ABC transporter ATP-binding protein OS=Staphylococcus aureus subsp. aureus LGA251 GN=mntA PE=3 SV=1
MLETKDLNLFLGNKHVLKNISLSIPVRGEIIGIMGPNGAGKSSLIKSLIGEFNATGTKLLYNKPIQQQLQHITYIPQKAH
IDLDFPISVEQVILSGCYKEIGWFRRPNKSARDKLKQLLSDLELESLRHRQISELSGGQLQRVLVARALMSESEVYFLDE
PFVGIDFSSEKLIMTKIENLKQQGKLILIIHHDLSKAKQYFDRIILLNQTLRYFGDSEEAMSVTRLNETFMSSTDCSDPS
QRSNITC