TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G0Q1A2|G0Q1A2_STRGR Aegerolysin domain-containing protein OS=Streptomyces griseus XylebKG-1 GN=SACT1_0756 PE=4 SV=1
MFLKPTSRSSRTTIRSILTTAALLGSALALAPATHAVAATTPASASSTAGAFSGTGAESPVSTLAQRSTRITVTNSTGQG
MQRVWSKLSHGCWTNDELPPDNIPAGRSTAFGSESCGLATGTEGETNFAVPGGQVEIRWNNPFVGSNSYSCTTPSGYYCS
RSGGSGNNANVHFTIAYAGLRAAATTGAPGAPVEDGTVSAQAARSTHVTLNNNSGALLSRTDARLSWGIWSDNQLPAVNI
NPGNRSSWQSESDGFMTGTQGSVTYVVSTGGHVTVKWNNPYAGSNKYECIAPANRTCSYSGGSGDNATVSFTLS