TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G2EDH3|G2EDH3_9FLAO Exosortase family protein XrtF OS=Bizionia argentinensis JUB59 OX=1046627 GN=xrtF PE=4 SV=2
MKKLLLKYKSVIKFILTFLAVYVVLSFSYKLYLDLSTGTDYYPDYVTHAVAQQTAHLLNTWGYHSQVLPHLDEPTMKLIL
NGKYIARVIEGCNSVSVIILFVAFILAFSGKFKVTVIYILSGSVFIYVVNLIRIVLLSIGLYHYPQHEAILHTVIFPAII
YGLVCFLWLVWVNRFSKIATNK