TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G4NCY6|G4NCY6_MAGO7 Uncharacterized protein OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MGG_14701 PE=4 SV=1
MDTSDHAIARRHIPYGITAPQNDEEQRVLSIAIVIASSLSILGAGCIILSFATFRGLRLFRHRLILGLAVSDFLRAVVIL
VPAALDLANQPLTAASNYSACVCDGFMVQLFVTQSDYWILTIAIYTFIIVTGQKQTAAWIDNHQPVVLVIPWALSLISAG
VSLTITSYNDIGSWCWIHQESVRLWYNFVPRWTIIVAMLVMYARISVVLRKAQRGFGTAVSKKTTAGRPSSGEPKPDGIN
AFEPLSLAEEGGRCSVTENSNRLRKLARHMAMYPIIYIILWILPTIVVLYHVSTNTAAPFPLQTVDKSFIVIQGFVNAIT
YGVSESSVACWRTLFFSQDIEEITEQDGPHFPGSPRGMTSEQRNSNALISQSLSMPLAPESPSGSIYEELGNDADNHHPA
VFDNETGSLGLDDLGDSLDHSAENTSIL