TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G4VI72|G4VI72_SCHMA Tyramine/octopamine receptor OS=Schistosoma mansoni GN=Smp_134460 PE=3 SV=1
MNHLFSSNNTFPENEYRMEACHENISYGLFSTNSNFINDLVNLTKVESEMFSEWRFALNIIIISLQILSGIFIFCGNLLV
ISAVATTKVLRRITDLYIVSLALSDLLVAVLILPLSIMRQVYGHWPYESHELCTYWISLNLFLCSASTFNICCISVDRYI
AINYPMKYISKRTRSTAFAMIGGAWIASFLIMIPPIFGSQHHTGVGSCYARSDARYRFIIAISTFFVPSLLVGFIYIRIF
WVIRRRSKEFKFGNFSSNPKEHRFGSFKLLFNTNNIYNQSFGHKMNRFSLHNSSQRQLFVTNSTQSNLFIAYTPRIKHKN
TEEYTVNQSHVQSTSTSCFNKRSEQIEQMVSIPMFHGKTKSDPNDFSSFPIHSNTENTEIHALQTTGTIDKTVDASMNDR
QKDQQREDEHRINSQNRRIVNSKPKHSSTRSVIYQRRKLLVYNSEKKTVKTVALVVCCFVLCWLPFTTLYLMEGVCECLY
SEAIFMATTWIGYLNSMCNPFIYAFCNAKCAKAFKRLLHIGSNS