TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G4Z100|G4Z100_PHYSP Putative G-protein coupled receptor OS=Phytophthora sojae (strain P6497) OX=1094619 GN=PHYSODRAFT_310761 PE=4 SV=1
MKQSWSFEREDRSHFLIERFGFGPSGRMDVRVTDVAIEAADGSTEGADIQAGLLFVHQDELWEAVALLDDVVGDVDLQDN
DDPMMLATGQDQQAQDGDAQDKCALQLRRDSRWVDLADERTWNVSRGAEHVALDGPEGGGHNGPLKVGFYYIFYAQCTPG
LQVSFHMDAMFKNGAKDFFSVGDAPLPVVYLTTSLLFLTAAAAWGWCLATRRDFVQRVHWLMAMLVGVKTVALFAEAMRA
YYMRRNGDTLTAWTAVSYAFMSLKGLLLFSVLLLIGTGWSLLKPHLSQRDKSVLSLVLVLQVVSNTAQILEAETAVGTRA
WVSWRDVLLLTDVACCAAVLLPIVWSIRQLRVAAATDGKAFANLQKLTQFRSFYLLVISYIYVTRLVIQLLQASLPYDAT
WVAVAVSELAALAFFTITGYRFRPLPVNPYLEVPMHEDDLEEFALDDDEDDLDFRNIQRTDIRKFAYGAPVKTKASNQVQ
TKTGTSSPERTSYAKKRSGSFNSDL