TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G5EE02|G5EE02_CAEEL Protein TRP-2, isoform a OS=Caenorhabditis elegans GN=trp-2 PE=2 SV=1
MTSSEASEFRMIEDDDDVSNNVTWTESDNSRLREKQFLLSCERGDIGSVRKLLAGISTETFNINCLDPLGRNALLIAIEN
ENIEMIELLLDHNIETGDAILYAIGEENVEAVEIIVEHLEKMDKFDSERQGVEITEHSAFTPDITPIVLAAHKDNYECIK
LFLDKKGTVPHPHDVRCSCPECYVAREEDSLRLSRSRINAYRALTSPSLICLSARDPILYAFELSWELKRLSFIENEFRT
DYEELSQKCQKFCVHMLDQVRGSKELEVVLNHTTNAWHDVTSANYGNPEKLARLKLAIQLSQKRFVAHPNCQQLLLDIWY
EGVESVRCTNFIYKLIFYILGMLSFPLFSLVYLLAPHSSMGQFAKKPFIKFLSHSGSYIFFLILLIMASQRMNVIDNILR
TDDVDRKETRGPPPTIIECAIFLWVLGLIWVEIKQLWECGLYNYCRNLWNILDFITNSLYLCTTALRVVAYVQVEQEALR
ANSVHIARHLPRRDWDAWDPTLLSECFFATANIFSSLKLVHIFTVSPHLGPLKISLGRMVIDIVKFFMVYALVLFAFACG
LNQLLWYYASMRQNECNLYEQYKNEKSLSYKYEHLKESCDDKYKSCSSIYHTAETLFWALFGLVDLTHFRLKEDHFLSEW
TGKTIFGSYCCCSIIVLLNMLIAMMSNSYQYISDQADIEWKFARSRLFLEYFDDTATLPPPFNIVPSPKSIYYCLHYLTK
KLCNCTKLQQPSKQKSMRNQKILRSVNDRENNYRKTIIHAEQLQVELEQSESESFTSFKIQINRYYTSRCYPVTCVEQKI
AASKTSPYEFRHLQSQ