TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G5EG02|G5EG02_CAEEL Protein EGL-19, isoform a OS=Caenorhabditis elegans GN=egl-19 PE=2 SV=1
MSVLASMMSSGEDEEQAAADEQERTDLWQQTLQAAVAASSSQDATKKRPAQRKPLRQTNVVERSERSLLCLSLNNPIRKL
CISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWN
ILDFIIVVIGLVSTILSKMSIQGFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGL
ELFCGKLHSTCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNMGVRWECSSNTTWPGPNNGITNFDNFGLAMLTVF
QCVSLEGWTDVMYWVNDAVGREWPWIYFVTLVILGSFFVLNLVLGVLSGEFSKEREKARARGLFQKFREKQQLEEDLKGY
LDWITQAEDIEPVNEDEQEDEPVAQTVVGEEADEEGEERVEDVRPSKWAARMKRLEKLNRRCRRACRRLVKSQTFYWLVI
LLVLLNTLVLTSEHYGQSEWLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDLM
KPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKFNFNPQQPKPRANFD
TFVQALLTVFQILTGEDWNTVMYHGIESFGGVGTLGVIVCIYYIVLFICGNYILLNVFLAIAVDNLADADSLTNAEKEEE
QQEIEGEDEEFEEGEDEGEEHGMDEPEGDEEMTSARPRRMSEVPAASTVKPIPKASSLFILSHTNSFRVFCNMVVNHSYF
TNAVLFCILVSSAMLAAEDPLQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLT
SFVLRTDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTFFLCNDLS
KMTEAECRGEYIHYEDGDPTKPVSKKRVWSNNDFNFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAV
ALFFIAFIIVIAFFMMNIFVGFVIVTFQNEGEREYENCELDKNQRKCIEFALKAKPHRRYIPRNRLQYRVWWFVTSRAFE
YVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITYGK
LNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFFGKVALDDSTSIH
RNNNFHSFPAAILVLFRSATGEAWQDIMLSCSDREDVRCDPMSDDYHKGGLNESRCGNNFAYPYFISFFMLCSFLVINLF
VAVIMDNFDYLTRDWSILGPHHLEEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLACKRLVSMNMPLN
SDGTVCFNATLFALVRTNLKIYTEGNIDEANEQLRSAIKRIWKRTHKDLLDEVVPPAGKEDDVTVGKFYATFLIQDYFRR
FKKRKEMEAKGVLPAQTPQAMALQAGLRTLHEIGPELKRAISGNLETDFNFDEPEPQHRRPHSLFNNLVHRLSGAGSKSP
TEHERIEKGSTLLPFQPRSFSPTHSLAGAEGSPVPSQMHRGAPINQSINLPPVNGSARRLPALPPYANHIHDETDDGPRY
RDTGDRAGYDQSSRMVVANRKYADARIVGAARREIEEAYSLGEQEIDLAADSLAPLMQHVGMHDIRDINENSRSALLRPA
ENSSRQHDSRGGSQEDLLLVTTL