TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G8XSY3|G8XSY3_9BETA Envelope protein UL78 OS=Saimiriine herpesvirus 4 GN=UL78 PE=4 SV=1
MFSLRTEMLLHGAMMGMFVAAAMLILLAVAMCFVAAKRRCVPYAVNIFAGNLLVSQLLTIVAMMFSQGFMYDPPFNPSYC
RISMFFEDVGTYATSALFLFLIMDRMAALANGRAEWKHQTQQNVSTAIFASIFAWALSAVVSLPTFVTSDSAHRFPFSCE
TPLGYSAMTMSLHVWFALAAPLIVVVSYVLGACYEEERDNLWPYVARVWTFYTTCLLFFVPYYGIRIIRSFFGLPGMFPE
VMDYVEVVCHMVFLFRVVILPLFVLNLSSPAPMVEMDHAFESMMKVGFCQETMLAVWKKFREVCRRNPSGDKLKLMDDFE
RGPVFVADLPSKS