TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G8ZNA0|G8ZNA0_TORDC Uncharacterized protein OS=Torulaspora delbrueckii (strain ATCC 10662 / CBS 1146 / NBRC 0425 / NCYC 2629 / NRRL Y-866) GN=TDEL0A07620 PE=4 SV=1
MWLLTLFACLFVVLYSFVAVNRYFSFKLHKNTYPLTLTILTLNMVMLLFTTYLLPLDIFDATKAASSESPSPSGNGTEQS
IEPRPSGLASINSANEVTHNFRVAWLLVYWLEFAICWFIIPVLISYCGLKYAFARNQSGSHHRSPILERLTRAVFQNLKF
YLLCLLGLICGLVYLVASTGHGLGDFKPLIISLSHLYSLSYTLILLSTGLIIFPKNLISTGRLPNNDTINRYFVELSKTN
DDLNESQMNMLEIAEKILHSSESNNGDVVFDQMLNECKLEVQGILNEVQLSISNHFSGSNSSHINNLHKLNNNYNNFMTN
YYSFLHYQTHSNSIIHILAQSQSLNSTPSTSSVWKYTKSILILPLSLISIALSLLVVFLEMTPSKWGHGWIFDGTHWYNF
CLQFIIFTYNTLVSLYAMSKFKFSNFHLIPNGRSNPTNALYYSLYSSRLLFPLCFNLMVLIPSKTEHRGKSSFEKTLYDN
LTVIPLADYLNRYLPTIIMAIIIVSYKFNIKQKVLLKVLGEEYYYQFFGMMMYEPVGDSDSMQRNDARSDSLLPDADNGF
GDRSRMDEDYEYSLQDGRCLFERASSNYNMSTNEEHESQDNNSSLRSYL