TCDB is operated by the Saier Lab Bioinformatics Group
>GAQ84256.1 outer envelope protein of 80 kDa [Klebsormidium nitens]
MAGQFQREGGENILEREQNSADLMEALSRVMHLSRPSERHQHRKVEERRKVPLHAKLVEDVISSASRTWSKVQHCLESEQ
RRTRYGRHANFASISGALGTEAGIGGAAAGVVSKGAGQTPKEPGLSGLRENLDESGAVEKPEWTSEQQKRGREGRFLIHE
VQILDSEGNDLEMDHPELKSLIQKTMKISNRPGFAFNVKEVHEDIDRLGRLGVFENVVPYTKDTRDGVVLQLHIAPHPVV
RKVVVKGSDVLPTSLIQKETKPLINKVLNMNELYEVIDRFKTWYIDKKFFAAVKPETLDPDGTLTLTAHEPRLRRIDVKV
QSGDNPDKVGGYTKMSTIKRNLILKEGQLMNGETLRENKQLLHSMGIFADVNIIPTEVFDGENGEPDAVFPWEGEGIPGG
YQLALRERYNGKNNRGSVQVAGGLNGAGGDFLSGLSFSSAWSHSNLFGEGKRLRLEGEKGAGIFKCELDYLDPWLDGDNK
RTGRRIQIRNLKTVDHIHCPKPEDMAGDPGRTGGSPAIAKRLACIEYSRPLRPEWLGRAGIQYQSATLKDDFGETQLLDM
YGSPLTFSGKPRDDALVVYGNLSWNTQLFLSMKQGLPIAPNWLCFNEMTANWKKGLVVNDYLELQARLQAGTVVGDLAPY
DAFELGGTGSVRGWQDGELGTSKSHVSGSLEAIIPVKPNLLEGVLFVDAATDFGSGKHVLGDPAGVRGRPGKGYGFGGGV
RVMSPIGPIRLEYGVNDRLQGRYHFGLG