TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H0Z4A2|H0Z4A2_TAEGU MARVEL domain-containing protein OS=Taeniopygia guttata OX=59729 GN=PLLP PE=4 SV=1
MAGLPGAARARSASPGSPPALDGSFLLSPLGGLMGVQAVLGLLVWSLIAATTYHLHAAYGWVMFVSLFFWILTLLFFVTY
LLQLHQKFYMIPWPLVLMIYNAVATVLYITAFVTCAAAVQPTSWRQWDYNRRAAASFFACVTMITYGVSTFFSFRAWKGL
GSNAATSQVTDHA