TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H1RRJ5|H1RRJ5_COMTE Putative uncharacterized protein OS=Comamonas testosteroni ATCC 11996 GN=CTATCC11996_14293 PE=4 SV=1
MLALQGIHQHLSAEQKQDIAIAAVQTTPGAASAGAARLGGLPLSDWAVVATIADVALQAAYLIWKWHRDYMHEQARQELR
DKAKAAVGGTP