TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H1X8H0|H1X8H0_WEICO APC family amino acid-polyamine-organocation transporter OS=Weissella confusa LBAE C39-2 GN=WEISSC39_07015 PE=4 SV=1
MWRFLKRLLIGKPLKTLEEGSQHLSRTKALALLSSDALSSVAYGTEQITTALIAASTVALWLQIPIAILVLVLLTAITLS
YRQIIHAYPSGGGAYVVTSTNWGRNAGLVAGGSLLVDYMLTVAVSVAAGTEAITSAVPALHPYSVGIGVVIILILMGINL
RGVRESAGFLMVPVYLFIVMITGMVLYGLYNIATGQVAFHAAAAIGTSSSSITILLFLRAFSSGSSSLTGVEAISNAVPN
FKEPKPRNAAATLSIMALILAFFFGGITFLSYWYGIRPNDHVTVLAQIGQTIFGHGVMFYLLQIATALILAVAANTGFSA
FPQLAFNLAKDKFMPHIYMDKGDRLGYSNGIMSLAVGAIVLLLIFNGSTEALIPLYAVGVFVPFTLSQSGMIIHWFRERE
GFWLGKASINFVGAFISFALVIILFWMHFKSVWPYLIIMPVLLRMFWTINRHYKAVAKQLRVLSKEPIKRHHYDGSTVIV
LVSNLTKATADAIDYAQSMGDRVLAMHVSFDSNPEKEHRLGVEFKREFPDVRYVDIHSSYRSITEPSLRFVDEIAKGAKE
RNHSLTILIPQFVPRHGWQNALHNQNSLRLRTALASRDVTVSTYYFHLKE