TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H2CBG8|H2CBG8_9LEPT Permease YjgP/YjgQ family protein OS=Leptonema illini DSM 21528 GN=Lepil_1655 PE=4 SV=1
MKLNKLDRYLGGEFIKGFFLALLGLLLVFLSVSINEAMKIESKQPRYLLYMHLLTTIPQLVVTITPAAIMFSVCFVVAQF
TMARELVAIFASGISFYRAVAVIFGFAFLLSAVLIAFQNYVVVPSNRVSLDYMEQYRKNTKRKLDVVWQRSFRGKQAFYF
VQYLDRESNRVMGGFHILFFKPETTPLKPVRMVEAKNALSTGDRDWKLQLVRETFFDEELNVADVKLHVELPITLDEDLN
FFTRPRRDPSELNLAELLDEIENRESAGFSATDYRVHFHATIAFPFMCFIVAVVGAIAGNMGSLRSGGPLIRALLLSTAT
IFFYIMSIRIGQNLGENNILPPFVAGWASTAVFAVISVVLVIKHRR