TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H3CHK0|H3CHK0_TETNG Mal, T cell differentiation protein a OS=Tetraodon nigroviridis OX=99883 PE=4 SV=1
PLERQSPQVPGPMSSPAAVGGNLPSGTGICTTIPDILYLPELIFGGLVWILVACTLVVPQNPQGWVMFVSVFCFVMTFIW
MVAFACGAHHHRGGWATADLLYHALAALFYLSASVSLAKVTLDLRNGSSFRNYQLDISAVVFSYVSTLLYCIHAILSAIR
WKS