TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H5WQY7|H5WQY7_9BURK Putative uncharacterized protein OS=Burkholderiales bacterium JOSHI_001 GN=BurJ1DRAFT_3967 PE=4 SV=1
MISARLSVLCLVAVLGACASVPTPPPAPDAVVAAPSDKVGQREYDRRPEVPFTVSLFDHPVQLTGSWEYTDETRGNFDLK
TSRVRDRRVRDHEIKLEARSRFGPDVEAYVQAVGLADARRTQGSPGVTRNRSLERGQTWVKVDRLGGTPWSVQVGRVALI
DRRAFWWDDDLDAVRALYNGDKWRLDTGFGREVARLSSADSAIPPGSKGVDRWFGQLTWKLPGRHTLDGFWLFQRDRSGT
PATGAAFADSDATDPSDFNGRWLGLRASGEFRPDNGWRLGYWADGAVVRGRERRTSFNDANVATGTSQRRVRGHALDLGA
TLVATMLPLRPALIVGHARGSGGESSPTLDANFRQTGLHENKARVAGVKRLRNYGEVLQPDLANMAITQVGAGVRVLNNS
SIELLRHRFRQPVAARTISGSRLSASPLGSSRDIGVEWDLALSLREWRQWELTLRWSRFKPGAAFADNERDPAHALELGA
ALNF