TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H6L5X3|H6L5X3_SAPGL TonB-dependent receptor plug OS=Saprospira grandis (strain Lewin) GN=SGRA_3817 PE=3 SV=1
MQSLPYLGLVLLLFCFSNPLWSQEKVSLSGYLRDAETGEELLFANVAIPAEAMGVSTNEYGYYALSLPKGQYVVSYSYVG
YQTILDTIDLQADLVKDIELLPESTTVDAVVVTDERTDENVKSTDMSVLSLDMKEAKKVPVIFGEQDIVKTLQLMPGVSP
SSEGGSGFFVRGGNADQNLILLDEAPVYNAAHLLGFFSVFNSDALKDVKLYKGGVPAEFGGRASSVMDVHMKNGNSKKFS
GSGGLGLISSRLTLEGPIVKDKGSFIVSGRRTYADLMFQLVADDFDGGSLYFYDLNLKANYKLGQKDRLYLSGYFGRDVF
GFDGSGLDWGNATLTLRWNHLFNEKLFANTTFVYSEYDYGFAVRTDNFDIDLAAGINNLNLKQDYSYYLNPNNNIKFGWQ
SLYYHFRPGSFEATDSETDDVLGSAKLAQQYALENAVYISNQHKINKKLSMNYGLRLTSFSNIGATTVKTYNEANEAIDS
VSYGSGEFFNTYFGLEPRVNAVYLLDDKSSIKASYNRIYQYLHILSNASSGTPTDIWAPSTQLIKPQYADQVALGYFRNF
LDNKLEFSVEGYYKQLGNQVDYEDGAETFLNEDLEAELVFGQGRAYGMEVFLRKRQGKFTGWVSYTLSKSERQFADINNG
NWFSARQDRRHDISVVGVYDITKKWSISAAWVYYTGDAITFPSGKYEVDGQIVNLFSSRNGDRMPDYHRLDIGATYVFRD
SKKWYSDINFSVYNAYNRKNAYSISFQENEAGTGTEAVRLALFGIVPSISWNFKF