TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H7FLH6|H7FLH6_9FLAO Uncharacterized protein OS=Flavobacterium frigoris PS1 GN=HJ01_00024 PE=4 SV=1
MQNDKFKSYLNLHLIVFIWGFTAILGALITISADAIVWYRMLLAGAFLGAFIVFKKKSFRIPATALLKLVFVGLLIALHW
ITFFHAIHVSNVSITLSIFSLGAFFASLLEPLFYGRKVLWYEVLFGLVIIAGLGMIMKVEISYLEGMIYALVSIILGVLF
TLMNGKLIEKHDSSVISFYEFMSGVFFISIYFLYQNKFSADFFVLSVNNWILILILASICTAYAFTASVKVMEKLSPYTV
MLTTNLEPVYGIILAYFIIGGKEKMSTSFYIGAVIILITVILNGIIKHQDKKVKA