TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H8BDK1|H8BDK1_CAMJU TonB-dependent heme receptor OS=Campylobacter jejuni subsp. jejuni 110-21 GN=cje3_06676 PE=3 SV=1
MHPNKKAFKLSLFALLLITNLNAQESNKAINLQKVVVSTTGFEQDADSNLRNVISIEGKDLQNKGYVSLEQALERISGIS
FVNFGLGRNIDMRGQGDKSNIAVKVMIDGRAINVLDNSHGVTPLDSINLDNVERIEIIPGGGSVLYGSGTRGGVINIITK
KQKSDAFAINLKSSAYDHGGLGGNLGINGAKQINENLAFSFDIQSFNLDGYQEGYNEKGYFINTKTYININDNSDLTLGY
NYFKSKNTSSGYLTKAQAQSDPTQKGNSDNITQINRPEISLDYHYYFDDIWEFNLEAFWQNQKINYLKDVSTMSYGSMSL
PVYQNGSGFEDTLTGISLKNKLNYANNSYFIFGYEFANHDAKRTSIIHYDVNAGRFQMSHTMTTLMDMDKQSHSIFALDS
HEFNDIFSISGGARYEYSLYDTNRNYTSNMIIPGRPNIKTELFSTDDTSHNFAFEITPNFKYSDTGKLYIKYERGFVSPS
PAQFVNKDKNLQKYYSANLNPEIFDTFELGIDDFWWDFYGFNLTLFYTLSKDEISYLGNPHSTSGSWWKYYNIDQTRRLG
VELSLSQNFLDDDLIFRESLTYLDAKISKGVNDGMRIPYVSKIKATAGFEYAWNKNFSNFIDLTYFSRAKDGGTIDENTG
KMSKNSWIRDYFLTDIGMKYNYKKLQILAGIRNLFDKRYYTYQDSINDQYLVGNGRNYYVEFKYAF