TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H8JS16|H8JS16_VIBCL Uncharacterized protein OS=Vibrio cholerae IEC224 GN=O3Y_07095 PE=4 SV=1
MNKYLVLALATVATFFAVGVKANTYGSVYMDTYEWSGLYGDNATKEAGTDTSYAVGVEAGYMDETFNVYGFHEEYSLNSR
FSKVTTHVALNENPMSLYVQGSYYEDAYGNEGRALAGVGYPIQFKGELLEFNFAPFVGYAWADSTFNVEDSVMVGWSGNT
KLLGLNLTSWHETDRQQGEWTMNGALGAYLDIDEDWYTGVQYRYWYNTGGNDGFADAVIARVGMRF