TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H8WCB7|H8WCB7_MARHY Putative membrane protein OS=Marinobacter hydrocarbonoclasticus ATCC 49840 GN=MARHY0253 PE=4 SV=1
MDATHDTLINVTLLNILLVCAVVVIHNEVLIRLSGLLARMRQSHHFRLIVAVLGCLTAHALQVWIFATAFYFMHHAEGWG
QLTGNFSGTMLDCAYFSFTTFTTLGYGDIEAVGQLRHLTGIEALTGLMLITWSASFLFLEMQRYWPTR