TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H9IW41|H9IW41_BOMMO Uncharacterized protein OS=Bombyx mori PE=4 SV=1
MEDNRFVVSTVEGECKKNGIHMGANIISRPLRSSLETVERGVTNAQPDTWLHDAGWRRKRSLAQLTREALPRMENYRNSK
RALKRPSLGELHGDHLITEEGVLIPCLLNIWGVMLFLRISWVVSQAGIGWSLVIIALSAVVCVITTLSMSAICTNGEVKG
GGIYYIISRSLGPEFGASVGIIFAFANAVAASMNTIGFCDSMNHLLKSLDLQIIDNSYNDVRIIGAIALFVMCVICAVGM
DWESKAQNFLIAIIVGAIVDFVVGAVMGPKSNLEVAEGFVGLSTSTFVENFNSDFKYSEGMEQNFFSVFAIFFPSVTGIQ
AGANISGDLKDPASAIPKGTLLALLISMVSYAMMVLFTGAAALRDASGNITDLVISNGTVTNYSAVSQCANSTLFPCKYG
MHVDFEIMQLMSAWGPFIYAGCWAATLSTALTNLLSVPRLIQALGVDRIYPGLIFFSKPYGRHGEAYRGYVLTFLVSLLF
LLIAKLNAIAPLISNFYLASYALINFCTFHAALVRPLGWRPTFKYYNVWVSLAGFLMCVGIMLLISWIMSLVTIAIFFTL
YLIVHYRNPDVNWGSSTQAQMYKTALSSAHNLARTGEHVKNYWPQLLVLGGRAHARPPLVDLGSLITKAGSLMIIGDISK
EKLSYKVCSARARADNEWLQERKVRAFCSLVHGFNFEQGARALIQATGVGKLAPNVLLMGYKSDWTTASAEDLVAYFNVL
HTAFENRLAVAIVRVRGGLDYGAAGGGEEGAGSLTVTSSGSGELHVRRSDALIMHADSDLDIHTDSSAKNNLSNILTLST
SRSFTITDAKDIKDKKKKDKRPTDMHRQIIYNAANGIELSKDQLTQMSIFKRKQESGTVDVWWLYDDVGLTILLPYIISQ
RSAWGNCKLRIFALANRLNEMELEERNMANLLSKFRIDYSSLTMVQDITEPPQAETKALFDETIKKFTSDSAAPECRISE
TELTTLSGKTNRQLRLRELLLANSRDSRLIVMSLPMPRKGSVSAPLYMAWLEMMSRDLPPMLFVRGNHTSVLTFYS