TCDB is operated by the Saier Lab Bioinformatics Group
>HCO29007.1 TPA: hypothetical protein DIT54_06255 [Lachnospiraceae bacterium]
MRQVLKNECKRAFFNKGMLLGLGVGIGIALWHAWQYILAPDVESVNVFCMESVFYNWIGASSYPIQSYLYYFILPLLAVL
PAGTSLYQDLHTGYIRQVYTRISRKDYFIAKYISVFLSGGFVVTVPLLLNFYMAMVRFPLLKPEPIMDYGPDRTSFGFEF
YYSHPVVHTVIFLIITFLFAGGFAGIACLTTYYTEYKIVVWLTPFVCYYFLFVLQALIKNDKIMIAPNYFLIPGFSLNTI
WDYIGGIVLFLIVAIWCYRKGSVYER