TCDB is operated by the Saier Lab Bioinformatics Group
>HHN35100.1 TPA: hypothetical protein ENM07_03110 [Bacteroidetes bacterium]
MNYRFLISYFLGLILGNLSIFIFSNFEYLGINLFYLFKSGNLINSFYEYFWLGFQFNIFDLFINKLDYTYFIDVFYPAMI
GWLFTGLISGTIIKGTKRAMLNALIIVVSILIIWIILAMLSGANLTFLFFTNLYKTIGGILSLLIFLELGTIIGSLLVGK
YIE