TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I0XVQ9|I0XVQ9_9LEPT Transporter, cation channel family / cyclic nucleotide-binding domain multi-domain protein OS=Leptospira licerasiae serovar Varillal str. VAR 010 GN=LEP1GSC185_1946 PE=4 SV=1
MITLKNRIRVYWDILVFICIFWASLESPLRIVINYDPNLLLTCIYFFIDFVFALDILWNCFTPEYKDGKWILTRSQVIKD
YLGSWFIIDLIAALPLEYATTTIFGLQQSQYPYLYLLLGVTRILKVFRISDILQRINLAFQPTPGILRLVLFAFWATLVA
HWCAVGWLYVDDLLDYQTGWSEYIIALYWTVATIATVGYGDITPSTDSQRIYTIFVMILGAGVYATVIGNIASILGSLDL
AKAAQRKKMAQVDSFLKARNISQNIRRRVRDYYMYIIDRGWGEDENALLNDLPISLRREVKIQLHRDLLEKVPFLKGADP
ALVTSLVFSMKPMIFLEGDTIFRRGEKGDDLYILSEGSVDILDSDEKTILLSLQEGQFFGELALVMDAPRSATVRATTTC
EIYTLSKTDFDNVLKRFSQFRSAIEESVAHLKKR