TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I3IJ02|I3IJ02_9BACT Uncharacterized protein OS=Candidatus Jettenia caeni GN=KSU1_C0101 PE=4 SV=1
MIWFLIGVIAAICSSIGFIPQIIQGIKTKSLSDVSPAMMTIVVVASSLWLAYGIHIKNSTIIFSNVSTLSFAIITLLLRF
LFKPEFVQLKRKLLSIPIKNRLILLLITFTLLPFVLLRILAYPRIQADVQEVLIRNLEGIVHKQAELVTNWIYERVKNAR
VIANNPLIAKGTEITKEDKDYPEIVQYLEEIKNEYGYKGIMMSNNKGLVTVTTSGESIGRDILQTDYFHGAMQGDSFVSS
IVPSEIPLINEYAEEELGIPTMFVSTPLKDKGGNITGVVALRIDVSRLNDVMLSLNLGKTGKTYLVNKDGYMITESRFAG
YLRDMGLIKKRCALELRVIDRETGKVTQGVQQCISGNNGFDAQGYKDYSDVTVLSAWRWLPKFHWGVIAEIDKDEGYGVA
YNLNYIVWGVLLILAFPFVMVAYLVGKKLSVPILKLTEVTKKMASGDLAQRVDIQREDELGELASSFNVMAKSLDEKTKE
IIISEKRYREIFNSIKEGVYQSDPGAEGVFTFINKAGAEILGYSTPEEVIGTKVKHIYVDPEDRRRLCDKLEKDGVWREF
VSLCKRKSGESFYAERTSSMLRDEKGNPAAIYGVFRDISERKKAEMEVIESEKRYRLLFDSLKEGVYQSEPEVDGVFTWI
NQAGAEILGYKSPEEVIGLKVKDVYVNPDDRKELIDTLEKDGIWRSFILYCRRKNGERFISESTCNLVRDEAGKPVRIDG
ILRDITER