TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I4ED78|I4ED78_9CHLR Uncharacterized protein OS=Nitrolancea hollandica Lb GN=NITHO_140022 PE=4 SV=1
MTIGLGLLIIGGTLAVAIGWLINRRVTHESFLWIGLVVGGVAFLLAGILQNLMVVPMAITIHGREGLQSLVPASPLEAIY
YGLAAGIAQELAKLAGIRVYGRNREIFPTAIAIGAGFALTEIILISLPAMQAGVTSVSALAIPIWERFSAILFHIGAAII
IGYGLARGKMWLYLLIAILLHGILDGAVALRAYYKIDQIVAFETVILIFSAAVLALAIRWMQSAVRDHELVSTTR