TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I7I0H5|I7I0H5_LEGPN Putative to nasA protein OS=Legionella pneumophila subsp. pneumophila GN=phtB PE=4 SV=1
MNQNSFKPKNNFVSLVMWALPLSFFTFQFLLRLWPGLTMQEIMAQFSIDAASFGLIAAFYYYGYAGMQIPVALLLDKFGA
RFVVFAFAMLCGIGTLVFIGTNNFYLALSGRFLIGVGSAAGFLGVSKVVSEWFSHSQYSRMIGFSFSVGLLGAIYGGKPL
AHLIQNFSGQQVGLALVVFSILLGCCALLILRSPPNNTHSVTKTMNLSHCSFLFSSWIIWALALANLLMVGALEGFADVW
GVPYLIAKYALNKTDAAFLISFIFMGMIFGGPLLAFLSQKLGNYFVIALCGAGLAFLFLILLYTATLHWWQLGTLFFAIG
LLCCYQVIVFAAGSTLVPYEGLGVTIAFLNCINMLGGSFFHTLIGKLMDSSWSGQMSANGLKLYEMESYQWALSLIPFCA
LCGSLLIVLIHIKTRAYAAPELMKKTSLTGV