TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I8CU19|I8CU19_MYCAB Uncharacterized protein OS=Mycobacterium abscessus 5S-0304 GN=MA5S0304_0303 PE=4 SV=1
MIARLVATSFIVAMLGFLDTVPASAEPREMAPQSYSRTTRDGWQLQIRLDHEQVNPVPNLAGATNSREAFITLSGTATAT
GGSNPITDSLFVIGYQLGCQSDVSSGLQIGGSAGVAPSVSLGVAPTPSVGVGGSAGVSGFVQTVVQPGVIVNLPMGNMVL
SRGGTGALDLDNVHVKADACGGDVTIRSFASLRASTETGHTEFAIYGDPIKI