TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I9SUL5|I9SUL5_BACOV Uncharacterized protein OS=Bacteroides ovatus CL03T12C18 GN=HMPREF1070_04340 PE=4 SV=1
MQYAPAAVMLGMKVAGVQSRSSWGRMLVSDAFSALLMGGVVNTLKQTTNVERPDGSNKHSFPSGHTATAFMTATMFTKEY
GHKSPWVGVGAYSVATATGLMRMANNKHWLSDVLTGAGIGILSTEVGYYFADLIFREKGINRFANENMFDRMDKPSFVSL
YLGLNIPLSGYDINEEMEFRTSSGSSAGVEGAYFFNPYVGVGGRFTVSNTLIIVNEERAENNTFDAISLCGGSYFSYPLS
SRWLIGSKLLGGYVHYPQLELTDRSVSSRSGFCMGSGVSLTFKAKEYYGIRFFLDYNLLPSHSRNSGEYMNMLTLGSSFM
ITF