TCDB is operated by the Saier Lab Bioinformatics Group
>tr|J2IMD3|J2IMD3_9BURK Cytochrome c biogenesis protein OS=Burkholderia sp. BT03 GN=PMI06_04969 PE=4 SV=1
MDFPPGTYALGFLAGALTTLSPCVLALLPILVASALAAHRLGVVVLAAGLSVSFSVIGIFVVTVGVSLGLDNDVFRRVAA
ALMILFGLAMFSRRLQAAFNRAAAGIGGPSQRWLSRIKGNTLAGQFAVGLLLGAVWSPCVGPTLGAATTLAAQGRNLANI
ALLMCIFGIGASLPLAILGSLSRASILRLRGRLRSVGSAGKTVLGTLFIAIGLLALTGLDKTLETALLSASPAWLTAFTT
SL