TCDB is operated by the Saier Lab Bioinformatics Group
>tr|J4K5X9|J4K5X9_LEPIR PF13372 domain protein OS=Leptospira interrogans str. FPW2026 GN=LEP1GSC080_0501 PE=4 SV=1
MKKNAIFKVSAGALLFCCIIPLNLFSQNSKKEKTNGPVLNLDPPSDVRYEEQPNDGKGIPEIQEELAKEEPYKSPYKGKL
PGEFMKSMLLSPEHQEAIRRTDKLWFGDIFRTGFQIRPRFDYSHNADFDKRTQDDRNYATQNSQVFFVVDPNPYVAAKVT
IQDVRVFGGEQSRKDGQLGYLGLSNSAGIELSSAPTANNSVSIKNNTDLREGFVQLKNFADGFEIFIGRQIFGFGDNRYV
GGRNDGQTGNSFDGARVKYNSKYFNSEAFTSIIAEDSNAGAGNNTANGVKRGTVNDTYLSGLYNTVKFEDFNVDLYYFNV
DRKWEQGPNPVTSQDRTRQRDDLNTVGFRLTNRTDNNRLPKTKAWDWTLEASWQYGYNGQRVNAGWDTLKQTVDGNPNSK
RIYTERVEYDSKFFIAQTGYTFFDRFRVGIQYSIGSGDPNRTDNKVATYDASFATRSGGFPYFDSGNGIANATFWSNTRT
KSIHLMYNSPNYGRFIFVVYDIQKASVNDAWYSSGGAANTGLTTENPTGAAFGGYKLGEKGGKRLFYEFDLIYQFYLKDY
VSIWTGGSYLLAGDAVRNARVNPWAPNINDRYTLDNRAYSFFLFVQFAM